DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC17A4 and dmGlut

DIOPT Version :9

Sequence 1:NP_005486.1 Gene:SLC17A4 / 10050 HGNCID:10932 Length:497 Species:Homo sapiens
Sequence 2:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster


Alignment Length:456 Identity:130/456 - (28%)
Similarity:221/456 - (48%) Gaps:23/456 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    39 LALILQLCNFSIYTQQMNLSIAIPAMV---NNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMA 100
            ||::..|...:.||.::.||.||..:|   |:|...|:  |..|....|          |..::.
  Fly    23 LAIMGFLAILNAYTMRVCLSQAITVLVVKKNSTDDDSE--AICEPDDID----------EGTSVG 75

Human   101 PAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYVVGAGLFISSFLTLFIPLAANAGVA- 164
            ..::||.|:||:||||...|..:..||.|.:|..||.|:.:|.|:..::..|:..|||.|.|.: 
  Fly    76 GDFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDSD 140

Human   165 LLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQLTTIAGSGSMLGSFIVLLAGGLLCQTIGWP 229
            .|||.|::.|:.:.........:...|.|..||.:|..:...|..:|:.:..|..|:.....||.
  Fly   141 WLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGWE 205

Human   230 YVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLA----QQDCSPGWSLPIRAMIK 290
            :|||.|||:|.....::..|.|.||.:||||...|:.|:|..:.    .:|..|   .|.:|::.
  Fly   206 FVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPP---TPWKAILT 267

Human   291 SLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGLLADFL 355
            :||::|::.:.....|.||.::...|.|::.|||.:::.:|:.|:||:|:..|..:..|.:||::
  Fly   268 NLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVADWM 332

Human   356 LSRKILRLITIRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDI 420
            :.|.:|.....||:.|.:....|::.:|...:......:.:....:...:.....:|..::.||:
  Fly   333 IRRGVLSTTNTRKVMTGLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAYYAGMKLSPLDM 397

Human   421 APRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFGWRNVFLLSAAVNISGLVFYLIFGRADV 485
            :|.|.|.|..:......|.|.|:|...|......|...||.||.::..|.....|.|.|:...:|
  Fly   398 SPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFTAVIYCIWASGEV 462

Human   486 Q 486
            |
  Fly   463 Q 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC17A4NP_005486.1 UhpC 30..491 CDD:332119 130/456 (29%)
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 126/452 (28%)
MFS 77..458 CDD:119392 111/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.