DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDH7 and CadN2

DIOPT Version :9

Sequence 1:NP_001349367.1 Gene:CDH7 / 1005 HGNCID:1766 Length:785 Species:Homo sapiens
Sequence 2:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster


Alignment Length:746 Identity:217/746 - (29%)
Similarity:336/746 - (45%) Gaps:157/746 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    66 LYVGKLHSDVDKGDGSIKYILSGEG------ASSIFIIDENTGDIHATKRLDREE-----QAYYT 119
            |.|.....|||: ..:|.|.|:|:|      |:|.|.|:..||||...|.|||::     |..:|
  Fly   158 LQVTATDGDVDR-PINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFT 221

Human   120 LRAQALDRLTNKPVEPESEFVIKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPT 184
            :.||  |. ..:.:...::..:.::|||||.|:|..|.|...|.|....|:||:.::|.|.|||.
  Fly   222 VFAQ--DE-GGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPN 283

Human   185 YGNSARVVYSILQ-------GQPYFSVEPKTGVIKTALPNMDREAKDQYLLVIQAKDMVGQNGGL 242
            ...:|:::|||.:       |.|.|.:||:||:||||:..:|||....|.:.:.|.|    .|||
  Fly   284 ESTNAKLIYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GGGL 344

Human   243 SGTTSVTVTLTDVNDNPPRFPRRSYQYNVPES-------LPVASVVARIKAADADIGANAEMEYK 300
            .||.:.::.:.|:||.||:|.:..:...|.|:       .|:.:|..:      |.......:||
  Fly   345 KGTGTASIRVKDLNDMPPQFTKDEWVTEVDETNGTYIPETPILTVTVQ------DEDETNTFQYK 403

Human   301 IVDGDGLGIFKISVDKETQ-EGIITIQKELDFE---AKTSYTLRIEAANKDADPRFLSLGP-FSD 360
            :|...|.|..|.::.:... .|.:.|.:.||:|   ..:.:..||:..:|..|      || .||
  Fly   404 VVPNSGFGADKFAMVRNGDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDD------GPGGSD 462

Human   361 T-----TTVKIIVEDV-DEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPD-SSNSPVRYSIDRN 418
            .     :.|.:.:.|: |..|.|......:.:.|.|:||.|:....|.|.| ..:|.|.|.|.|:
  Fly   463 KYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRS 527

Human   419 TDLERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGYVAITILDINDNAPEFA 483
            |:.:|.|.| ::.|.::..:.|||||...|:|.:||::..:|::.....:.:.:.|:|||||.||
  Fly   528 TNRKRQFAI-SDRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFA 591

Human   484 MDYETTVCENAQPGQVIQKISAVDKDE--PSNGHQFYFSLTTDATNNHNFSLK-------DNKDN 539
            .||:.|:.||.. |:.|.:::|.|.|:  ..||..|.|.|...|::......|       || :|
  Fly   592 QDYKPTLPENVS-GKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDN-EN 654

Human   540 TASILTRRNGFRRQEQSVYYLPIFIVDSGSPSLSSTNTLTIRVCDCDADGVAQTCNAEAYV---- 600
            ..:|::....|.|:.|..|.:||.|.|:|:|:::.|:|||:.:.|.: |...|..:....|    
  Fly   655 GVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVN-DNKMQPGSKSVLVYNYQ 718

Human   601 -----LPAG------------------------------LSTGALIAILACVLTLLVLILLIVTM 630
                 .|.|                              ..||                  |:||
  Fly   719 GQSQDTPIGRVYVNDPDDWDVPDKKYYWEVQEHQRFKLDTDTG------------------ILTM 765

Human   631 R---RRKKEPLIFDEERDIRENIVRYDDEGGGEEDTEAFDMAALRNLNVIRDTKTRRDVTPE-IQ 691
            |   ||.:..|.|..          ||.| .|:||..|       ||:|     |.||:|.| :|
  Fly   766 RAGTRRGRYQLRFKV----------YDRE-HGQEDIPA-------NLSV-----TVRDITAEAVQ 807

Human   692 FLSRPAFKSIPDNVIFREFIWERLKEADVDP 722
            .........|.|....|  .|..:|. .|:|
  Fly   808 QAGSMRLSHITDEDFVR--TWNPVKN-QVEP 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDH7NP_001349367.1 CA 73..151 CDD:214520 30/88 (34%)
Cadherin_repeat 157..258 CDD:206637 39/107 (36%)
Cadherin_repeat 266..373 CDD:206637 26/124 (21%)
Cadherin_repeat 382..478 CDD:206637 30/96 (31%)
Cadherin_repeat 486..584 CDD:206637 34/106 (32%)
Cadherin_C 631..779 CDD:307269 28/96 (29%)
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 30/93 (32%)
Cadherin_repeat 256..359 CDD:206637 38/106 (36%)
Cadherin_repeat 379..481 CDD:206637 24/113 (21%)
Cadherin_repeat 489..586 CDD:206637 30/97 (31%)
Cadherin_repeat 594..703 CDD:206637 35/111 (32%)
Cadherin_repeat 724..801 CDD:206637 24/117 (21%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.