DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rps6ka2 and S6k

DIOPT Version :9

Sequence 1:XP_002942396.3 Gene:rps6ka2 / 100495717 XenbaseID:XB-GENE-487242 Length:732 Species:Xenopus tropicalis
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:419 Identity:189/419 - (45%)
Similarity:260/419 - (62%) Gaps:43/419 - (10%)


- Green bases have known domain annotations that are detailed below.


 Frog    15 FSVYLH----KKSRTKTSSFNRYE--DEGIVKEIDISHH---------------VKEGFEKAEPS 58
            |.:.||    :..:.:.|..:|.|  |..:..|:.|:.|               |..|..|..|.
  Fly    11 FDLELHDLELQDDKARDSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENVNPGKIKLGPK 75

 Frog    59 QFELLKVLGQGSYGKVFLVRKVKGSDSEQLYAMKVLRKATL--KVRDRVRSRMERDILAEVNHPF 121
            .|||.||||:|.|||||.|||..|.|:.:.:|||||:||::  ..:|...:|.||:||..|.|||
  Fly    76 DFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPF 140

 Frog   122 IVKLHYAFQTEGKLYLILDFLRGGDLFSRLSKEVMFTEEDVKFYLAELALALDHLHSFGIIYRDL 186
            ||:|.|||||:|||||||::|.||:||..|.:|.:|.|:...|||:|:.|||.|||..|||||||
  Fly   141 IVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDL 205

 Frog   187 KPENILLDEEGHIKITDFGLSKESIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMF 251
            ||||||||.:||:|:|||||.||.|......::|||||||||||::.|.||.::.||||.|.|||
  Fly   206 KPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMF 270

 Frog   252 EMLTGSLPFQGKDRKETMALILKAKLGMPQFLSSEAQCLLRALFKRNPCNRLGAGLDGVEEIKRH 316
            :||||..||..::||:|:..||||||.:|.:|:.||:.|:|.|.||....|||:|.:....::.|
  Fly   271 DMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIH 335

 Frog   317 SFFSTIDWNNLYRKEIKPPFKPAVGRPEDTFHFDPEFTSRTPTDSPG---IPPSANTHNLFRGFS 378
            .||..::|:::..:.::||.||.:...:|...||..||.:.|.|||.   :..|||.  :|:||:
  Fly   336 PFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANL--IFQGFT 398

 Frog   379 YVAPNLDYNPHDSYNSSVHPIVQQLHGSN 407
            ||||:               |::.:|.:|
  Fly   399 YVAPS---------------ILEDMHRAN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rps6ka2XP_002942396.3 STKc_RSK_N 64..380 CDD:270734 165/320 (52%)
STKc_RSK3_C 410..702 CDD:271080
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 166/322 (52%)
STKc_p70S6K 81..402 CDD:270736 167/322 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.