DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf43 and rnf13

DIOPT Version :9

Sequence 1:XP_002935238.2 Gene:rnf43 / 100491274 XenbaseID:XB-GENE-952685 Length:689 Species:Xenopus tropicalis
Sequence 2:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio


Alignment Length:366 Identity:83/366 - (22%)
Similarity:141/366 - (38%) Gaps:104/366 - (28%)


- Green bases have known domain annotations that are detailed below.


 Frog    13 LLLTVTLQAVASAMGTTEREMDVKALIRVTPLQAEESGGVGQGNLT--LEGLFARVAEISPAEGR 75
            :||::.:..:::....|...:.:.|.:.:.|::|:.| .....|.|  .:.|.||.....|:||.
Zfish     1 MLLSLGMLMLSATQIYTIFTVQIFAFLNLLPVEADIS-AYSFDNKTENFDDLPARFGYRLPSEGL 64

 Frog    76 ---LLQFHPLSLCNTSEDDQTKPGFISIVKLETPDRDTQPCLSLANKARLAGERGAHAVL---FD 134
               |:...|.:.|               |.:|.|.:          :..|:   .|..||   ||
Zfish    65 KGFLIGARPENAC---------------VPIEPPPQ----------RENLS---SAFIVLIRRFD 101

 Frog   135 ITNDRGALQQLQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEV------QEQPKWLHHD- 192
            ...|...|.  .|.||..  ..::...|::.|:.:.:::.:.|.:|::      :|....|..| 
Zfish   102 CNFDIKVLH--AQKAGYK--AAIVHNVDSDDLISMGSEDLDILKQIDIPSVFIGEEAANSLKEDY 162

 Frog   193 ----------------------IWILLTVAGTVMFFVLYAVARLLCRQPPPQDSIQQQTLLAISR 235
                                  |..|:.|...::..|::.:.:.          :|.:.....||
Zfish   163 IYEKGGHVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKF----------VQDRHRARRSR 217

 Frog   236 LGTRRYQQRMLKDQRASGGWVETASTSSSVPVCAICLEEFTDGQELRILPCCHEYHLGCVDPWL- 299
            |  |:.|.:.|...:...|        .|..||||||:|:.:|:.||:|||.|.||..|||||| 
Zfish   218 L--RKDQLKKLPIHKFKKG--------DSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLT 272

 Frog   300 RQNHTCPLCMY-------------DILDSGTPPRPLAHRAP 327
            :...|||:|..             |.:|||.....::...|
Zfish   273 KTKKTCPVCKQKVVPSDGDSESDSDSVDSGGEDNEVSENTP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf43XP_002935238.2 ZNRF_3_ecto 80..182 CDD:375639 20/104 (19%)
HRD1 <244..366 CDD:227568 34/98 (35%)
RING-H2_RNF43_like 267..311 CDD:319580 26/57 (46%)
RING-H2 finger (C3H2C3-type) 268..308 CDD:319580 24/40 (60%)
DUF4573 523..643 CDD:373595
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 36/189 (19%)
zf-RING_2 238..282 CDD:290367 25/43 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.