DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf43 and arp5

DIOPT Version :9

Sequence 1:XP_002935238.2 Gene:rnf43 / 100491274 XenbaseID:XB-GENE-952685 Length:689 Species:Xenopus tropicalis
Sequence 2:NP_596039.1 Gene:arp5 / 2541031 PomBaseID:SPBC365.10 Length:721 Species:Schizosaccharomyces pombe


Alignment Length:131 Identity:25/131 - (19%)
Similarity:50/131 - (38%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


 Frog   573 HQQSMPQAASVV--QGSSEPDVATSLRGSRTDPPSRTYRKKKSSAPSHLPLLYSPRHCHPANSVQ 635
            :..:.|.::.:|  .|::...|...|.|.|....::......|.:.|:|..|:..:  :|:..::
pombe   158 YHNTKPSSSGIVLNLGNAASHVIPVLNGERILSEAKRISWGGSQSSSYLLKLFQIK--YPSFPIK 220

 Frog   636 MSESSHPRWAEEVRLLHSRVNS---------------HRENTAMMHLYHPPHHNQGATEEIEAVC 685
            |.    |..||.:...|..|:|               .|:...:...|......:.:.||:|.:.
pombe   221 ML----PSQAELLMHDHCHVSSDYTHDIAHALDRDILERDEIVLQFPYTEAAAQEKSQEELELIA 281

 Frog   686 E 686
            |
pombe   282 E 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf43XP_002935238.2 ZNRF_3_ecto 80..182 CDD:375639
HRD1 <244..366 CDD:227568
RING-H2_RNF43_like 267..311 CDD:319580
RING-H2 finger (C3H2C3-type) 268..308 CDD:319580
DUF4573 523..643 CDD:373595 13/71 (18%)
arp5NP_596039.1 COG5277 19..716 CDD:227602 25/131 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.