DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thg1l and THG

DIOPT Version :9

Sequence 1:XP_002935942.3 Gene:thg1l / 100487878 XenbaseID:XB-GENE-966760 Length:294 Species:Xenopus tropicalis
Sequence 2:NP_001188815.1 Gene:THG / 34876 FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster


Alignment Length:265 Identity:143/265 - (53%)
Similarity:187/265 - (70%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


 Frog    26 MAKSKFEYVRDFEVQDTCLRNCWVLVRVDGRNFHRFAEQHHFTKPNDVRSLQLMNRCAQNVMDEL 90
            ||.|:||||:.||..|:.|.|.|:::|:||:.||:|::.|.|.||||..:|.:||..|..||.|.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

 Frog    91 DDICLAYGQSDEYSFVFHKKSNWYKRRASKFMTHVVSQFASSYVFYWKEYFPDVPILCPPGFDGR 155
            .||.|||||||||||||.|::..:|||::|.:|:|.|.|:||||..|.::. ::|:...|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

 Frog   156 VVLYPSEQNLKDYLSWRQADCHINNLYNTVFWSLVQKGGLTPAQAQDRLKGTLAAEKNEILFSEF 220
            ||||||||||||||||||||.|:||||||.||.||.:.|||..||:.:|:||.:|:|||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

 Frog   221 NINYNNEPLLYRKGSVLIWQKVNEVSKKRIKLPNEVDEKEVEVSRWRKETVILHCDVIGDQFWEE 285
            .|||||.|.:||||::|:        :||:.|    .||.      |:..|.||.|:|..|||:|
  Fly   195 GINYNNLPAMYRKGTILL--------RKRVIL----GEKS------RQAVVPLHEDLISSQFWKE 241

 Frog   286 HSSIL 290
            |:.||
  Fly   242 HTEIL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thg1lXP_002935942.3 Thg1 27..283 CDD:226508 136/255 (53%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 136/255 (53%)
Thg1 9..134 CDD:282322 64/125 (51%)
Thg1C 137..234 CDD:291110 61/114 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4379
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5959
Inparanoid 1 1.050 287 1.000 Inparanoid score I2779
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152974at2759
OrthoFinder 1 1.000 - - FOG0004478
OrthoInspector 1 1.000 - - oto102391
Panther 1 1.100 - - LDO PTHR12729
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.