DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stx7 and Syx7

DIOPT Version :9

Sequence 1:XP_002936355.1 Gene:stx7 / 100379927 XenbaseID:XB-GENE-1004004 Length:259 Species:Xenopus tropicalis
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:268 Identity:95/268 - (35%)
Similarity:146/268 - (54%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


 Frog     8 DPAQLAQTISGNIQKITQSSSEIQRIVNQLGTVQDTAELRNRLQEKIQYAHKIAKDT-------D 65
            |..:|||.|:.:|||:.|:.|.:||:||||.|.||:.||:.:|.:.:.|.:::..||       |
  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEVD 86

 Frog    66 RCLKDYASLPLESDQRQRKLQKDRLVSEFSSVLNNFQKIQRQAAEKEKEF----------VARVR 120
            :|           .:|..|:|:||||.||::.|..||.:||:.|:.||..          :||..
  Fly    87 KC-----------KERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPP 140

 Frog   121 AGSRVSGGFPDDSQKEGSLLTWEN-----EGQPQATMQEEEITEDDLHLIEERETAIRQLEEDIQ 180
            ..||........||::.:....:|     ..|.|...|.||  :.||..:||:|..||:||.:|.
  Fly   141 GSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEE--QADLQALEEQEQVIRELENNIV 203

 Frog   181 GINDIFKDLGMMVHEQGEMIDSIEANVENADVHVQQANQQLARAAEYQRKSRRKICIIIAVLVVA 245
            |:|:|:|.||.:|:|||..:||||:.||...:.|.|..:.|.:|:.|:.|.|:|..|::.:|...
  Fly   204 GVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAV 268

 Frog   246 ATVIGLII 253
            ...|.||:
  Fly   269 LLAIILIL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stx7XP_002936355.1 Syntaxin_2 16..116 CDD:373109 40/116 (34%)
SNARE_syntaxin7 165..224 CDD:277228 27/58 (47%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 40/106 (38%)
COG5325 <97..276 CDD:227635 64/180 (36%)
SNARE 188..247 CDD:304603 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8900
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37823
Inparanoid 1 1.050 155 1.000 Inparanoid score I4205
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - otm47591
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3589
SonicParanoid 1 1.000 - - X633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.