DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUX4 and CG9876

DIOPT Version :10

Sequence 1:NP_001280727.1 Gene:DUX4 / 100288687 HGNCID:50800 Length:424 Species:Homo sapiens
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:137 Identity:45/137 - (32%)
Similarity:56/137 - (40%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    83 RPWPGRRGPPEG--------RRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQ 139
            ||.|.....|.|        ||.||..:.:|...|.:.||:..:|....|||||.:..|.|:|:|
  Fly    98 RPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQ 162

Human   140 IWFQNRRAR----HPGQGGRAPAQAGGLCSAAPGGGHPAP------SWVAFAHTGAWGTGLPAPH 194
            :|||||||:    ....|.|.      |...|| ...|||      .:....|        |.|.
  Fly   163 VWFQNRRAKFRRNERSVGSRT------LLDTAP-QLVPAPISNNMHKYANMPH--------PHPQ 212

Human   195 VPCAPGA 201
            .|..|||
  Fly   213 PPPPPGA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUX4NP_001280727.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
homeodomain 25..78 CDD:238039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..102 9/26 (35%)
Homeodomain 95..149 CDD:459649 25/57 (44%)
PRK07764 <141..319 CDD:236090 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..362
Required for interaction with EP300 and CREBBP, and for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:26951377 327..424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..414
Important for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:29618456 405..424
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.