DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDCD6 and pdcd6

DIOPT Version :9

Sequence 1:NP_037364.1 Gene:PDCD6 / 10016 HGNCID:8765 Length:191 Species:Homo sapiens
Sequence 2:NP_001008004.1 Gene:pdcd6 / 493366 XenbaseID:XB-GENE-960916 Length:184 Species:Xenopus tropicalis


Alignment Length:191 Identity:155/191 - (81%)
Similarity:171/191 - (89%) Gaps:7/191 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTV 65
            ||.|..:..|       .|..:||||||||||||||:|||||||||||||||||||||||||.||
 Frog     1 MAYYQQQNRP-------PGNTMPDQSFLWNVFQRVDRDRSGVISDTELQQALSNGTWTPFNPATV 58

Human    66 RSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQF 130
            .||||||||::|.||||:||:|||||||||||:||||||||||:|||||||||||||||||||||
 Frog    59 NSIISMFDRDHKGGVNFNEFSGVWKYITDWQNIFRTYDRDNSGLIDKNELKQALSGFGYRLSDQF 123

Human   131 HDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV 191
            :|:||||||||.|||:|||||||.|||||||||:||||||||||||||||||||:|:||:|
 Frog   124 YDVLIRKFDRQRRGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLTMIFSVV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDCD6NP_037364.1 EFh_PEF_ALG-2 27..191 CDD:320058 145/163 (89%)
pdcd6NP_001008004.1 EFh_PEF_ALG-2 20..184 CDD:320058 145/163 (89%)
EF-hand motif 20..49 CDD:320058 27/28 (96%)
EF-hand motif 57..86 CDD:320058 22/28 (79%)
EF-hand motif 87..117 CDD:320058 27/29 (93%)
EF-hand motif 123..152 CDD:320058 23/28 (82%)
EF-hand motif 153..184 CDD:320058 27/30 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I28211
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7880
Inparanoid 1 1.050 318 1.000 Inparanoid score I10347
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto147959
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4200
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.