DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arhgap11a.1 and cv-c

DIOPT Version :9

Sequence 1:NP_001121463.1 Gene:arhgap11a.1 / 100158559 XenbaseID:XB-GENE-1010876 Length:946 Species:Xenopus tropicalis
Sequence 2:NP_001097786.1 Gene:cv-c / 41749 FlyBaseID:FBgn0285955 Length:2351 Species:Drosophila melanogaster


Alignment Length:234 Identity:75/234 - (32%)
Similarity:110/234 - (47%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


 Frog     8 RGLAKLAVVQHL-RSCGIKIKNWNSKQRPELGKATAQVLL----SGKVFGTPLHSLPYQYLPEYG 67
            |.||.:.:..|: |.|......||.    ||.|...::.:    ..||||.||    ...|...|
  Fly  1853 RKLALVTLTGHMERYCPSHRSGWNW----ELPKFIKKIKMPDYKDKKVFGVPL----LMILQRSG 1909

 Frog    68 -NVPVILVIVCKSLEKH-LNTEGLFRKSGSVARQKLLKTKI---DNGENCLTT---ALPCDVAGI 124
             .:|:.:....:.|:.: |:..|:|||||..:|...|:.:|   |:...|:..   ....|||.:
  Fly  1910 QTLPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMKLREQIEVTDSTAECMDVFDLQQAYDVADM 1974

 Frog   125 LKQFFRELPEPVLPTDLQDAFYKA-QHLSTDSERISATMLLTCLIPERTVQILQYFFSFLHAVAL 188
            |||:||||||.:|.|.:.:.|... |||..: .|:.|......|:|:...:||.....||..||.
  Fly  1975 LKQYFRELPESLLTTKMSETFVAIFQHLPAE-VRLDAVQCAVLLLPDENREILYVLLEFLTIVAA 2038

 Frog   189 RSDANKMNSNNLAVIFAPNLLHS--NDDGEKISPSTEKK 225
            .|..|:|.||||.|..|.::.||  :.....:|.|..:|
  Fly  2039 NSQQNQMTSNNLGVCLAQSIFHSSISTGSASVSASPRRK 2077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arhgap11a.1NP_001121463.1 RhoGAP-ARHGAP11A 50..250 CDD:239859 63/187 (34%)
cv-cNP_001097786.1 SAM_DLC1,2-like 1382..1441 CDD:188937
RhoGAP_DLC1 1893..2116 CDD:239840 64/190 (34%)
SRPBCC 2148..2343 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.