DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf128 and SPAP32A8.03c

DIOPT Version :9

Sequence 1:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:41/137 - (29%)
Similarity:70/137 - (51%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


 Frog   236 IGKLQLRTIKQGDKVLGPDGDSCAVCIEPYKPSDVVRILTCNHFFHKNCIDPWLLEHRTCPMCKC 300
            |.|::::  |...:::..:|: |.:|:|.:|.:|.|..|.|.|:||:|||.|||..:.||.:|:.
pombe   377 IAKMKVQ--KPPKELIDEEGE-CTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTCAICRA 438

 Frog   301 DILKSLGIAEDEEETTSAAIPSVSSELQRSTVQTIEE----ENRSEMASS--------GYASVRG 353
            .:..: ....:...|.||...:.|:....||..|.::    .|.|..|:|        |::|...
pombe   439 PVDPN-SQQRNNTSTDSANGHNPSNHANPSTSTTNDQGATLRNESFNAASQSNLSSEHGHSSRTP 502

 Frog   354 GDEPVDE 360
            .|:.|||
pombe   503 MDDFVDE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037
COG5540 <208..302 CDD:227827 24/65 (37%)
RING-H2_RNF128_like 256..304 CDD:319716 20/47 (43%)
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 20/43 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.