DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf128 and H10E21.5

DIOPT Version :9

Sequence 1:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:206 Identity:72/206 - (34%)
Similarity:115/206 - (55%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


 Frog   188 SIFFVSVSFFIVTAATVGYFIFYSARRWRLTRAQNKKMKQLKAEAKKAIGKLQLRTIKQG-DKVL 251
            |:.|||:||.|:...::.:.:||..:|:|...|:::..::|...|:||:.::...||..| .:.|
 Worm   159 SVLFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITPGMTQEL 223

 Frog   252 GPDGDSCAVCIEPYKPSDVVRILTCNHFFHKNCIDPWLLEHRTCPMCKCDILKSLG----IAEDE 312
            ..|   ||||::||:..||:|:|.|.|.:||:||||||||||||||||.||||..|    |..|.
 Worm   224 QSD---CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGYWNDIRNDI 285

 Frog   313 EETTSAAIPSVSSELQRSTVQTIEEENRSEMASSGYASVRGGDEPVDEGQHIYENTELVHNEA-- 375
            :..|::.  .::.:.   |::....|...:..|:...|.....:..|.....::|:|..|:|:  
 Worm   286 QMPTNSR--GIADDF---TIRLELGEQEHQAPSADVISPEANSDTSDSQGFSFDNSEHHHSESFG 345

 Frog   376 SATSIEVLPHV 386
            ..||..|.|.:
 Worm   346 YGTSSTVPPQL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037
COG5540 <208..302 CDD:227827 44/94 (47%)
RING-H2_RNF128_like 256..304 CDD:319716 32/47 (68%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 63/173 (36%)
RING-H2_GRAIL 226..273 CDD:319582 33/49 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5695
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm21426
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.