powered by:
Protein Alignment kremen1 and HRD1
DIOPT Version :9
Sequence 1: | NP_001108389.1 |
Gene: | kremen1 / 100141352 |
ZFINID: | ZDB-GENE-070705-262 |
Length: | 465 |
Species: | Danio rerio |
Sequence 2: | NP_014630.1 |
Gene: | HRD1 / 854149 |
SGDID: | S000005373 |
Length: | 551 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 54 |
Identity: | 12/54 - (22%) |
Similarity: | 20/54 - (37%) |
Gaps: | 22/54 - (40%) |
- Green bases have known domain annotations that are detailed below.
Zfish 137 LTIQNCISFCRNQRYKLAGMESGYACFCGDDREYHRHGDAPNTECNHVCFGDHT 190
|.:|.|::|. |::|...:.:.|.||:..||.|
Yeast 203 LFLQTCLNFW----------------------EFYRSQQSLSNENNHIVHGDPT 234
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
kremen1 | NP_001108389.1 |
KR |
26..109 |
CDD:238056 |
|
WSC |
114..195 |
CDD:280068 |
12/54 (22%) |
CUB |
209..315 |
CDD:238001 |
|
HRD1 | NP_014630.1 |
HRD1 |
5..551 |
CDD:227568 |
12/54 (22%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.