DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kremen1 and HRD1

DIOPT Version :9

Sequence 1:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:54 Identity:12/54 - (22%)
Similarity:20/54 - (37%) Gaps:22/54 - (40%)


- Green bases have known domain annotations that are detailed below.


Zfish   137 LTIQNCISFCRNQRYKLAGMESGYACFCGDDREYHRHGDAPNTECNHVCFGDHT 190
            |.:|.|::|.                      |::|...:.:.|.||:..||.|
Yeast   203 LFLQTCLNFW----------------------EFYRSQQSLSNENNHIVHGDPT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:280068 12/54 (22%)
CUB 209..315 CDD:238001
HRD1NP_014630.1 HRD1 5..551 CDD:227568 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.