DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kremen1 and APE3

DIOPT Version :9

Sequence 1:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:26/120 - (21%)
Similarity:46/120 - (38%) Gaps:29/120 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish   197 GRIIVFDTKVGACGGNFTSPSAVIYSP---DFPGKYRSGSVCYWTIQVPGSSVILFNFTFFSIVD 258
            |:||.|:......|.:|.:.:|...||   .|.||         .:::|...           .:
Yeast   144 GKIISFNLSDAETGKSFANTTAFALSPPVDGFVGK---------LVEIPNLG-----------CE 188

Zfish   259 QKDMVELLDGKTN--QVVARFDGRNPPRDIVNITADF----VILYFYSDRTNEAL 307
            :||...::..:.|  |:.....|:.|..|..|:...|    |::|....::.|.|
Yeast   189 EKDYASVVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:280068
CUB 209..315 CDD:238001 22/108 (20%)
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 26/120 (22%)
PA_ScAPY_like 155..284 CDD:239045 22/109 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.