DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kremen1 and ZNRF3

DIOPT Version :9

Sequence 1:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio
Sequence 2:NP_001193927.1 Gene:ZNRF3 / 84133 HGNCID:18126 Length:936 Species:Homo sapiens


Alignment Length:262 Identity:50/262 - (19%)
Similarity:79/262 - (30%) Gaps:111/262 - (42%)


- Green bases have known domain annotations that are detailed below.


Zfish   154 AGMESGYACFCGDDREYHRH--------GDAPNTECN--------HVCFGDHTQPCGGDGRIIVF 202
            :|..|.::|       ||.|        .|.|.::.:        |....|....|         
Human   523 SGSTSSFSC-------YHGHRSVCSGYLADCPGSDSSSSSSSGQCHCSSSDSVVDC--------- 571

Zfish   203 DTKV------GACGGNFTSPSAVIYSPDFPGKYRSGSVCYWTIQVPGSSVILFNFTFFSIVDQKD 261
             |:|      |:| ..|.|..:..|.|..   |||.|.|. ..:..||                 
Human   572 -TEVSNQGVYGSC-STFRSSLSSDYDPFI---YRSRSPCR-ASEAGGS----------------- 613

Zfish   262 MVELLDGKTNQVVAR-FDGRNPPRDIVNITADFVILYFYSDRTNEALGFSVVYHALRNPAFRPEE 325
                  |.:.:..|. |:|..||.::..:.:                     :.|.|...:....
Human   614 ------GSSGRGPALCFEGSPPPEELPAVHS---------------------HGAGRGEPWPGPA 651

Zfish   326 EDNGDEEDTSTMRPNSGSTTT------KSNTSQSGKSSHLYYVITSSPANMPG---QWHGPGRTA 381
            ..:||:..|.::..|..|.::      .|:||:.|        :.:||...|.   .|.|     
Human   652 SPSGDQVSTCSLEMNYSSNSSLEHRGPNSSTSEVG--------LEASPGAAPDLRRTWKG----- 703

Zfish   382 GH 383
            ||
Human   704 GH 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:280068 11/56 (20%)
CUB 209..315 CDD:238001 18/106 (17%)
ZNRF3NP_001193927.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
zf-RING_2 293..334 CDD:290367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 608..693 21/136 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..758
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 849..875
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 892..936
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 510 1.000 Domainoid score I2629
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1025 1.000 Inparanoid score I2202
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG40703
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0013402
OrthoInspector 1 1.000 - - oto46572
orthoMCL 1 0.900 - - OOG6_113589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R768
SonicParanoid 1 1.000 - - X4852
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.