DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kremen1 and Rnf43

DIOPT Version :9

Sequence 1:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio
Sequence 2:XP_006247152.1 Gene:Rnf43 / 303412 RGDID:1305204 Length:802 Species:Rattus norvegicus


Alignment Length:125 Identity:29/125 - (23%)
Similarity:40/125 - (32%) Gaps:32/125 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish   323 PEEEDNGDE-EDTSTMRPNSGSTTTKSNTSQSGKSSHL-YYVITSSPANMPGQWHG--PGRTAGH 383
            ||....|.| :.:.|.||.|..:...  |.::..|||: |:...........|||.  ||...| 
  Rat   514 PEGALQGKEVQPSMTSRPRSLDSVVP--TGETQVSSHIHYHRHRHHHYKKQFQWHSRKPGLETG- 575

Zfish   384 NTMWTIYALAALLTLTVIAMVAKLLLHLTVKSPSIPSISGSESCAQSTTSEPWIILYRPS 443
                             :........| |...||:|.       .|.||..|.:....|:
  Rat   576 -----------------VPQSRPAASH-TQLEPSLPD-------QQLTTPNPAVSSMLPN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:280068
CUB 209..315 CDD:238001
Rnf43XP_006247152.1 ZNRF_3_ecto 85..187 CDD:408039
RING-H2_RNF43 270..316 CDD:319712
dnaA 598..>743 CDD:237605 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I28091
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I10108
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto66982
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4852
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.