powered by:
Protein Alignment kremen1 and plr-1
DIOPT Version :9
Sequence 1: | NP_001108389.1 |
Gene: | kremen1 / 100141352 |
ZFINID: | ZDB-GENE-070705-262 |
Length: | 465 |
Species: | Danio rerio |
Sequence 2: | NP_499473.2 |
Gene: | plr-1 / 176575 |
WormBaseID: | WBGene00023404 |
Length: | 487 |
Species: | Caenorhabditis elegans |
Alignment Length: | 75 |
Identity: | 19/75 - (25%) |
Similarity: | 30/75 - (40%) |
Gaps: | 18/75 - (24%) |
- Green bases have known domain annotations that are detailed below.
Zfish 309 FSVVYHALRNPAFRPEEEDNGDEEDTSTMRPNSGSTTTKSNTSQSGKSSHLYYVITSSPANMPGQ 373
|.|||. ..|.....|:.:|..:||:::.| .||.|.. :.|:|::...:
Worm 359 FDVVYK--HYPKVDSPEKLSGRSDDTTSLLP---------RTSPSED-------LPSAPSSRSTR 405
Zfish 374 WHGPGRTAGH 383
...|.||..|
Worm 406 LTRPYRTTHH 415
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto15676 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R768 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4852 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.940 |
|
Return to query results.
Submit another query.