DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kremen1 and plr-1

DIOPT Version :10

Sequence 1:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio
Sequence 2:NP_499473.2 Gene:plr-1 / 176575 WormBaseID:WBGene00023404 Length:487 Species:Caenorhabditis elegans


Alignment Length:65 Identity:17/65 - (26%)
Similarity:32/65 - (49%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish   309 FSVVYHALRNPAFRPEEEDNGDEEDTSTMRPNSGSTTTKSNTSQSGKSSHL-------YYVITSS 366
            |.|||.  ..|.....|:.:|..:||:::.|.: |.:....::.|.:|:.|       :::|.||
 Worm   359 FDVVYK--HYPKVDSPEKLSGRSDDTTSLLPRT-SPSEDLPSAPSSRSTRLTRPYRTTHHLIPSS 420

Zfish   367  366
             Worm   421  420

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:460348
CUB 209..315 CDD:238001 4/5 (80%)