DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kremen1 and plr-1

DIOPT Version :9

Sequence 1:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio
Sequence 2:NP_499473.2 Gene:plr-1 / 176575 WormBaseID:WBGene00023404 Length:487 Species:Caenorhabditis elegans


Alignment Length:75 Identity:19/75 - (25%)
Similarity:30/75 - (40%) Gaps:18/75 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish   309 FSVVYHALRNPAFRPEEEDNGDEEDTSTMRPNSGSTTTKSNTSQSGKSSHLYYVITSSPANMPGQ 373
            |.|||.  ..|.....|:.:|..:||:::.|         .||.|..       :.|:|::...:
 Worm   359 FDVVYK--HYPKVDSPEKLSGRSDDTTSLLP---------RTSPSED-------LPSAPSSRSTR 405

Zfish   374 WHGPGRTAGH 383
            ...|.||..|
 Worm   406 LTRPYRTTHH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:280068
CUB 209..315 CDD:238001 4/5 (80%)
plr-1NP_499473.2 zf-rbx1 305..358 CDD:289448
zf-RING_2 317..357 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto15676
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R768
SonicParanoid 1 1.000 - - X4852
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.