DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf145l and APC11

DIOPT Version :9

Sequence 1:NP_001106467.1 Gene:rnf145l / 100127651 XenbaseID:XB-GENE-5921670 Length:679 Species:Xenopus tropicalis
Sequence 2:NP_010276.3 Gene:APC11 / 851554 SGDID:S000002166 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:54/195 - (27%)
Similarity:73/195 - (37%) Gaps:81/195 - (41%)


- Green bases have known domain annotations that are detailed below.


 Frog   479 MGVSVIIVHSYFNVWLRAQSGWKSFLLRREAAKKISSLPMATLEQLRAHN---------DVCPIC 534
            |.|.:..|||.| .|     .|              .:| :|.::..|:|         |||.||
Yeast     1 MKVKINEVHSVF-AW-----SW--------------HIP-STSDEDAANNDPIGNDEDEDVCGIC 44

 Frog   535 FQDMSGA-------------VITPCSHIFHGECLRKWLYVQDT------CPICHQ---------- 570
            ....:|.             ||..|.|.||..|:.:||   ||      ||:|.|          
Yeast    45 RASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWL---DTPTSKGLCPMCRQTFQLQKGLAI 106

 Frog   571 ---QVKPLAETL-REGEEKSEE---EEEVEADEEVRAEVTAHGFRRNQCNPERGREEME--LGED 626
               .|:...|.: |..||..||   ||.|:.||.:         |:|..|| .||::::  |.||
Yeast   107 NDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPI---------RQNTDNP-IGRQQVDTILDED 161

 Frog   627  626
            Yeast   162  161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf145lNP_001106467.1 TRC8_N 5..500 CDD:290425 7/20 (35%)
zf-rbx1 <528..569 CDD:289448 20/68 (29%)
zf-RING_2 529..569 CDD:290367 19/58 (33%)
APC11NP_010276.3 zf-ANAPC11 1..102 CDD:403920 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.