DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf145l and apc11

DIOPT Version :9

Sequence 1:NP_001106467.1 Gene:rnf145l / 100127651 XenbaseID:XB-GENE-5921670 Length:679 Species:Xenopus tropicalis
Sequence 2:NP_593423.1 Gene:apc11 / 2543187 PomBaseID:SPAC343.03 Length:94 Species:Schizosaccharomyces pombe


Alignment Length:78 Identity:24/78 - (30%)
Similarity:29/78 - (37%) Gaps:20/78 - (25%)


- Green bases have known domain annotations that are detailed below.


 Frog   528 NDVCPICFQDMSGA-------------VITPCSHIFHGECLRKWLYV---QDTCPICHQQVKPLA 576
            :|||.||.....|.             |...|.||||..|::.||..   |..||:..|......
pombe    21 DDVCGICRVPFDGCCPQCTSPGDNCPIVWGKCKHIFHAHCIQNWLATSGSQGQCPMDRQTFVVAD 85

 Frog   577 ETLREGEEKSEEE 589
            .|    .||||.:
pombe    86 ST----NEKSETQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf145lNP_001106467.1 TRC8_N 5..500 CDD:290425
zf-rbx1 <528..569 CDD:289448 18/56 (32%)
zf-RING_2 529..569 CDD:290367 18/55 (33%)
apc11NP_593423.1 zf-ANAPC11 1..85 CDD:289620 19/63 (30%)
zf-rbx1 2..78 CDD:289448 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.