DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rnf145l and SPAC57A7.09

DIOPT Version :9

Sequence 1:	NP_001106467.1	Gene:	rnf145l / 100127651	XenbaseID:	XB-GENE-5921670	Length:	679	Species:	Xenopus tropicalis
Sequence 2:	NP_593372.1	Gene:	SPAC57A7.09 / 2542187	PomBaseID:	SPAC57A7.09	Length:	372	Species:	Schizosaccharomyces pombe

Alignment Length:	48	Identity:	17/48 - (35%)
Similarity:	24/48 - (50%)	Gaps:	4/48 - (8%)

- Green bases have known domain annotations that are detailed below.

Frog   531 CPICFQDMS---GAVITPCSHIFHGECLRKWLY-VQDTCPICHQQVKP 574
            |.||.:..:   ..|..||.|.||..|:.||:. .:..||.|:.:|.|
pombe   321 CVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEVPP 368

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rnf145l	NP_001106467.1	TRC8_N	5..500	CDD:290425
		zf-rbx1	<528..569	CDD:289448	14/41 (34%)
		zf-RING_2	529..569	CDD:290367	14/41 (34%)
SPAC57A7.09	NP_593372.1	COG5540	1..369	CDD:227827	17/48 (35%)
		Peptidases_S8_S53	<144..211	CDD:299169
		zf-RING_2	320..362	CDD:290367	14/40 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910