DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf145l and SPAP32A8.03c

DIOPT Version :9

Sequence 1:NP_001106467.1 Gene:rnf145l / 100127651 XenbaseID:XB-GENE-5921670 Length:679 Species:Xenopus tropicalis
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:33/135 - (24%)
Similarity:46/135 - (34%) Gaps:47/135 - (34%)


- Green bases have known domain annotations that are detailed below.


 Frog   510 AKKISSLPMATLEQLRAHN-------DV-------------------CPIC---FQDMSGAVITP 545
            |:.:..:....:||.:.||       ||                   |.||   |:.....:..|
pombe   349 ARGLDDIISQLMEQAQGHNAPAPAPEDVIAKMKVQKPPKELIDEEGECTICMEMFKINDDVIQLP 413

 Frog   546 CSHIFHGECLRKWLYVQDTCPICHQQVKPLAETLREGEEKSEEEEEVEADEEVRAEVTAHGFR-R 609
            |.|.||..|::.||.|..||.||...|.|          .|::......|       :|:|.. .
pombe   414 CKHYFHENCIKPWLRVNGTCAICRAPVDP----------NSQQRNNTSTD-------SANGHNPS 461

 Frog   610 NQCNP 614
            |..||
pombe   462 NHANP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf145lNP_001106467.1 TRC8_N 5..500 CDD:290425
zf-rbx1 <528..569 CDD:289448 19/69 (28%)
zf-RING_2 529..569 CDD:290367 18/61 (30%)
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.