DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rnf145l and rbx1

DIOPT Version :9

Sequence 1:	NP_001106467.1	Gene:	rnf145l / 100127651	XenbaseID:	XB-GENE-5921670	Length:	679	Species:	Xenopus tropicalis
Sequence 2:	NP_593388.1	Gene:	rbx1 / 2541897	PomBaseID:	SPAC23H4.18c	Length:	107	Species:	Schizosaccharomyces pombe

Alignment Length:	50	Identity:	13/50 - (26%)
Similarity:	24/50 - (48%)	Gaps:	7/50 - (14%)

- Green bases have known domain annotations that are detailed below.

Frog   529 DVCPICFQDMSGAVIT-------PCSHIFHGECLRKWLYVQDTCPICHQQ 571
            |:|..|..:...|...       .|:|.||..|:.:||..::.||:.:::
pombe    50 DLCIECQANTDSAAAQECTVAWGTCNHAFHFHCISRWLNTRNVCPLDNRE 99

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rnf145l	NP_001106467.1	TRC8_N	5..500	CDD:290425
		zf-rbx1	<528..569	CDD:289448	13/46 (28%)
		zf-RING_2	529..569	CDD:290367	13/46 (28%)
rbx1	NP_593388.1	APC11	19..107	CDD:227521	13/49 (27%)
rbx1	NP_593388.1	zf-rbx1	20..97	CDD:289448	13/46 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910