DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf145l and hrd1

DIOPT Version :9

Sequence 1:NP_001106467.1 Gene:rnf145l / 100127651 XenbaseID:XB-GENE-5921670 Length:679 Species:Xenopus tropicalis
Sequence 2:NP_596376.1 Gene:hrd1 / 2539900 PomBaseID:SPBC17D11.02c Length:677 Species:Schizosaccharomyces pombe


Alignment Length:359 Identity:81/359 - (22%)
Similarity:135/359 - (37%) Gaps:111/359 - (30%)


- Green bases have known domain annotations that are detailed below.


 Frog   280 YLALGMLNFCKFYLLGFDAFRNGNVMHRGVTEGVTLMLLALQTGLLDLQVLQRTFLLSIILFIVV 344
            ::.:| ||.|   |..|.|..|..         .||:..:|||  .:|::|...|.:::...::.
pombe    41 HITIG-LNVC---LCLFFAIANAL---------KTLLFGSLQT--FELELLYEQFWITLTEIMLA 90

 Frog   345 TSTLQSMIEIADPIVLALGATRNRSLWKHLRGVSMCLFLLVFPCFMAYK--------ISQFFHMD 401
            .:..:..|.|:..::|                 |..:|..||....:::        ..|.||:.
pombe    91 ITVFREAISISFFMLL-----------------STLMFARVFHSICSFRTERLQIQLTDQRFHIF 138

 Frog   402 FWLLILVSSCMLTSLQVLGTLFIYALFMVELFHDS-------------------QVEKIDEIIYY 447
            ..|     :|....|.:|....||..|..|...|.                   :..|:...:|.
pombe   139 SRL-----TCAYFVLSILDASLIYLCFTSEHLGDKSTRMLFVCEFSVLLLNLTIEASKLCIYLYE 198

 Frog   448 VNAVSRVLE------FLVAVC-----VVAYGTWESLFGEWSWMGVSVIIVH------SYFNVWLR 495
            ...:.:|.:      |.:.||     ::||    ||...:.:..|||.|..      .:::::.|
pombe   199 ARHLDQVWDEKSTYLFRLEVCRDGLRLLAY----SLLFMYQFPYVSVPIYSIRQMYTCFYSLFRR 259

 Frog   496 AQSGWKSFLLRREAAKKISSL-PMATLEQLRAHNDVCPICFQDM-----------------SGAV 542
            .:...:.    |:|.:.:::: |.||.|||...:..|.||.::|                 .|..
pombe   260 IREHARF----RQATRDMNAMYPTATEEQLTNSDRTCTICREEMFHPDHPPENTDEMEPLPRGLD 320

 Frog   543 IT----PCSHIFHGECLRKWLYVQDTCPICHQQV 572
            :|    ||.||.|..|||.||..|.|||||.:.|
pombe   321 MTPKRLPCGHILHFHCLRNWLERQQTCPICRRSV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf145lNP_001106467.1 TRC8_N 5..500 CDD:290425 50/263 (19%)
zf-rbx1 <528..569 CDD:289448 21/61 (34%)
zf-RING_2 529..569 CDD:290367 21/60 (35%)
hrd1NP_596376.1 HRD1 1..514 CDD:227568 81/359 (23%)
zf-RING_2 291..351 CDD:290367 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.