Sequence 1: | NP_001106467.1 | Gene: | rnf145l / 100127651 | XenbaseID: | XB-GENE-5921670 | Length: | 679 | Species: | Xenopus tropicalis |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_587745.1 | Gene: | SPCC548.05c / 2539314 | PomBaseID: | SPCC548.05c | Length: | 468 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 241 | Identity: | 56/241 - (23%) |
---|---|---|---|
Similarity: | 79/241 - (32%) | Gaps: | 90/241 - (37%) |
- Green bases have known domain annotations that are detailed below.
Frog 508 EAAKKISSLPMATLEQLRAHNDVCPICFQDMSGAVITPCSHIFHGECLRKWLYVQDTCPICHQQV 572
Frog 573 ----------------------------------KPLAETLREGEEKSEEEEE-----VEADEEV 598
Frog 599 --------RAEVTAH----GFRRNQCNPERGREEMELGEDRR-------DQTNGGERRCDAKHER 644
Frog 645 ------EEVEEE----DEGENSASGGGEGSHLE----GVGQVEVTD 676 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rnf145l | NP_001106467.1 | TRC8_N | 5..500 | CDD:290425 | |
zf-rbx1 | <528..569 | CDD:289448 | 14/40 (35%) | ||
zf-RING_2 | 529..569 | CDD:290367 | 14/39 (36%) | ||
SPCC548.05c | NP_587745.1 | RING | 84..126 | CDD:238093 | 17/49 (35%) |
COG2888 | <193..213 | CDD:268082 | 3/19 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |