DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC14 and meis1

DIOPT Version :9

Sequence 1:NP_001092082.1 Gene:SIGLEC14 / 100049587 HGNCID:32926 Length:396 Species:Homo sapiens
Sequence 2:XP_002931792.1 Gene:meis1 / 100488182 XenbaseID:XB-GENE-479439 Length:465 Species:Xenopus tropicalis


Alignment Length:205 Identity:44/205 - (21%)
Similarity:66/205 - (32%) Gaps:62/205 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    54 PPLYVYWFRDGEIPYYAEVVA--------TNNPDRRVKPETQGR--FRLLGDVQKKNCSLSI--- 105
            |||:.:     :.|:.|...|        .|:..:|.|....|.  |.||..:.:| |.|:.   
 Frog    43 PPLHSH-----QYPHTAHTNAMPPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEK-CELATCTP 101

Human   106 -------GDA----RMEDTGSYFFRVERGRDVKYSYQQNKLNLEVTA-------LIEKPDIH--- 149
                   ||.    ...:..:.|.:..|.....:|......||.:.|       |:|...:|   
 Frog   102 REPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELC 166

Human   150 ------FLEPLESGRPTRL--------SCSLPGSCEAGPPLTF--SWTGNALSPLDPETTRSSEL 198
                  ::..|:...|..|        |.|.........|||.  ||:      .|.:.|.|:..
 Frog   167 DNFCHRYISCLKGKMPIDLVIEDREGGSKSDSEDMTRSAPLTDQPSWS------RDHDDTASTRS 225

Human   199 TLTPRPEDHG 208
            ..||.|...|
 Frog   226 GGTPGPSSGG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC14NP_001092082.1 Ig_Siglec_N 21..140 CDD:143189 23/109 (21%)
IG_like 26..139 CDD:214653 23/108 (21%)
Ig 150..216 CDD:299845 17/69 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..209 6/19 (32%)
Ig 252..335 CDD:299845
IG_like 261..336 CDD:214653
meis1XP_002931792.1 Meis_PKNOX_N 108..192 CDD:374576 14/83 (17%)
Homeobox_KN 290..329 CDD:368670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I35468
eggNOG 1 0.900 - - E1_2CYFK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm54708
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.860

Return to query results.
Submit another query.