DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC14 and si:ch73-380l3.2

DIOPT Version :9

Sequence 1:NP_001092082.1 Gene:SIGLEC14 / 100049587 HGNCID:32926 Length:396 Species:Homo sapiens
Sequence 2:NP_001348166.1 Gene:si:ch73-380l3.2 / 100003913 ZFINID:ZDB-GENE-080303-1 Length:266 Species:Danio rerio


Alignment Length:215 Identity:62/215 - (28%)
Similarity:96/215 - (44%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    20 VYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLY---VYWFRDG---EIPYYAEVVATNNP 78
            |:::.|:..:......||::||:|:||...  ...|.|   ..|.:..   :|.:|.:...    
Zfish    23 VWKVDVEHKMKALVSSCVVLPCNFTYPVHQ--QQQPSYRIRGIWHKMNKWDDIIFYGDKTL---- 81

Human    79 DRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVE---RGRDVKYSYQQNKLNLEVT 140
               |:...:||.||:|.:...||||.|.:.:..|.|.|.||||   ..:| |||:..|.:::...
Zfish    82 ---VEDNFKGRTRLIGSLGSFNCSLEIDEVKNTDNGPYCFRVELETAPKD-KYSFVDNCVSITTI 142

Human   141 ALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSW--TGNALSPLDP----ETTRSSELT 199
            ....||.:.....:..|.|....||:..:|....| :|||  .|..:|..:.    .....|.||
Zfish   143 EEAPKPMLEAETSVLEGEPAIFKCSVRHTCPTYQP-SFSWNRAGKIISSYNDLGHGNWEAESLLT 206

Human   200 LTPRPEDHGTNLTCQVKRQG 219
            .||..||:.|::.|.||..|
Zfish   207 FTPTKEDNYTSIECTVKYHG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC14NP_001092082.1 Ig_Siglec_N 21..140 CDD:143189 36/127 (28%)
IG_like 26..139 CDD:214653 35/121 (29%)
Ig 150..216 CDD:299845 20/71 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..209 7/22 (32%)
Ig 252..335 CDD:299845
IG_like 261..336 CDD:214653
si:ch73-380l3.2NP_001348166.1 Ig 24..141 CDD:325142 36/126 (29%)
Ig 148..226 CDD:325142 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.