powered by:
Protein Alignment gng3 and Ggamma30A
DIOPT Version :9
Sequence 1: | NP_001165080.1 |
Gene: | gng3 / 100038286 |
XenbaseID: | XB-GENE-968597 |
Length: | 75 |
Species: | Xenopus tropicalis |
Sequence 2: | NP_001285776.1 |
Gene: | Ggamma30A / 45234 |
FlyBaseID: | FBgn0267252 |
Length: | 238 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 18/52 - (34%) |
Similarity: | 31/52 - (59%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Frog 17 RKMVEQLKIEASMCRIKVSKAASDLMTFCDAHACEDPLITPVPTSENPFREK 68
:|.:|.:|.:|||.|..:||:.:::.:|.:.:...||||.......||:.||
Fly 15 KKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEK 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
gng3 | NP_001165080.1 |
GGL |
13..75 |
CDD:128520 |
18/52 (35%) |
Ggamma30A | NP_001285776.1 |
GGL |
11..67 |
CDD:238024 |
18/52 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.