DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUXB and mxtx2

DIOPT Version :9

Sequence 1:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens
Sequence 2:NP_001073284.1 Gene:mxtx2 / 58078 ZFINID:ZDB-GENE-000710-6 Length:296 Species:Danio rerio


Alignment Length:255 Identity:59/255 - (23%)
Similarity:88/255 - (34%) Gaps:86/255 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    77 CFSEKDQTQGHDQSQHLTQEYLPKEARQKQTFITWTQKNRLVQAFERNPFPDIATRKKLAEQTGL 141
            |.::    .|:.|:..:.       .|:|:|..|......|..||..:|:|.|:.|:.|::.|||
Zfish     8 CIAQ----DGNSQASKIA-------GRRKRTSFTKEHLELLKMAFNVDPYPGISVRESLSQATGL 61

Human   142 QESRIQMWFQKQRSLYLKKSRMEPMNLLVDDPNERPDATVGWHPINLFLP--------------- 191
            .|||||:|||.:|:..||...::....| |:.:..|..         |||               
Zfish    62 PESRIQVWFQNKRARTLKNRAIQSSPQL-DNKSPLPSP---------FLPPHMASVGVSAQQRGI 116

Human   192 TDSSHYFSCSHSSSGHETLPPVLPSTQAPWDPFRFHVSQGPNVMIMQPTQAVQEGEKSDQPLIIP 256
            .:|......|.:|..|.|.||...||.                 :::|.|....|..|..|    
Zfish   117 QESPFNIQMSQTSPQHFTFPPSDYSTP-----------------VVKPRQTRLMGTSSCSP---- 160

Human   257 NHLLTLPILTKDLDTPTPFWLQYQEEHQNHKEHSGSGVPQVKSHSQPEPEHREQQPLNLG 316
                      .||......|           .::||        :|..||..:....|.|
Zfish   161 ----------SDLQATPDSW-----------SYAGS--------TQISPESWDVAAENFG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039
homeodomain 103..161 CDD:238039 26/57 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314 5/31 (16%)
mxtx2NP_001073284.1 HOX 22..76 CDD:197696 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6659
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46123
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.