DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUXB and hbn

DIOPT Version :9

Sequence 1:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:181 Identity:51/181 - (28%)
Similarity:82/181 - (45%) Gaps:46/181 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    86 GHDQSQHLTQEYLPKEARQKQTFITWTQKNRLVQAFERNPFPDIATRKKLAEQTGLQESRIQMWF 150
            |||    |:....|::.|:.:|..|..|.::|.:|||:..:||:.||:.||.:..|.|:|:|:||
  Fly   141 GHD----LSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWF 201

Human   151 QKQRSLYLKKSRMEPMN------LLVDDPNERPDATVGWHPINLFLPTDSSHYFSCSHSSSGHET 209
            |.:|:.:.|:.:.  ||      ||       |:..:...|:.:.||         .|...||. 
  Fly   202 QNRRAKWRKREKF--MNQDKAGYLL-------PEQGLPEFPLGIPLP---------PHGLPGHP- 247

Human   210 LPPVLPSTQAPWDPFRFHVSQGPNVMIMQPTQAVQEGEKSDQPLIIPNHLL 260
                 .|.|:.:.|..|.:.|..|     |..|...|       ::|.||:
  Fly   248 -----GSMQSEFWPPHFALHQHFN-----PAAAAAAG-------LLPQHLM 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039
homeodomain 103..161 CDD:238039 23/57 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314
hbnNP_788420.1 Homeobox 156..209 CDD:278475 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.