DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED6 and MED6

DIOPT Version :9

Sequence 1:NP_001271140.1 Gene:MED6 / 10001 HGNCID:19970 Length:257 Species:Homo sapiens
Sequence 2:NP_001163577.1 Gene:MED6 / 44728 FlyBaseID:FBgn0024330 Length:249 Species:Drosophila melanogaster


Alignment Length:254 Identity:114/254 - (44%)
Similarity:160/254 - (62%) Gaps:15/254 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVG 65
            ||:..:.::.|.:||.|:..:..|:..:|:|||..:||||||..||||.|:||||..|||:.|:|
  Fly     1 MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETVRMQRLGPEHLHNMIG 65

Human    66 IEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAF 130
            :||||||..||||::||||.|.:|::..|:||||||.|.:|:||||.:|||||:|..|..:||||
  Fly    66 LEYILLHVAEPILYVIRKQHRHNPSEATPIADYYIIGGTVYKAPDLANVINSRILNTVVNLQSAF 130

Human   131 DEAMSYCRYHPSKGYWWH------FKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFP 189
            :||.||.||||:|||.|.      |.|..:.||....:.:.|...::||:||||.||.:|.:|||
  Fly   131 EEASSYARYHPNKGYTWDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFP 195

Human   190 PKF-VQLKPGEKPVPVD---QTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMR 244
            |.. ..|:..::|.|..   .|.:.|..:.....|.:.:|     :.|..|.||||:.:
  Fly   196 PPIPPMLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKT-----EGVDMKPPPEKKSK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED6NP_001271140.1 Med6 13..139 CDD:282750 72/125 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..246 13/55 (24%)
MED6NP_001163577.1 Med6 13..139 CDD:282750 72/125 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153113
Domainoid 1 1.000 168 1.000 Domainoid score I3842
eggNOG 1 0.900 - - E1_COG5097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3990
Inparanoid 1 1.050 222 1.000 Inparanoid score I3546
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55402
OrthoDB 1 1.010 - - D1251252at2759
OrthoFinder 1 1.000 - - FOG0005042
OrthoInspector 1 1.000 - - oto90679
orthoMCL 1 0.900 - - OOG6_102673
Panther 1 1.100 - - LDO PTHR13104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2638
SonicParanoid 1 1.000 - - X5378
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.