Sequence 1: | XP_001344916.5 | Gene: | klf5a / 100006043 | ZFINID: | ZDB-GENE-090312-167 | Length: | 429 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572932.2 | Gene: | mamo / 32353 | FlyBaseID: | FBgn0267033 | Length: | 1553 | Species: | Drosophila melanogaster |
Alignment Length: | 394 | Identity: | 91/394 - (23%) |
---|---|---|---|
Similarity: | 129/394 - (32%) | Gaps: | 147/394 - (37%) |
- Green bases have known domain annotations that are detailed below.
Zfish 146 SSSGPAPSAL------PDFTSIFNSNSTSGSGMDVVDDSAGVFVKQEMQGF--DIPQDGP----- 197
Zfish 198 ------------------------LFQLLNSELDV----------------------------PD 210
Zfish 211 PTDPHAHSQMPTFHNLHLAAQQTAAKSYCGMAAHGYPLSHGHFVHPQDQAHSQLKMTYLPPSPPT 275
Zfish 276 SEPGSPDRQKELLHNLTPPPSYAATIASKMA----GHAPSHPTPASARPPTTTGS---------- 326
Zfish 327 --------------MPVRYNRRTNPD------------LEKRRIHH-------CDFPGCKKVYTK 358
Zfish 359 SSHLKAHLRTHTGEKPYRCTWEGCDWRFARSDELTRHFRKHTGAKPFQCAVCSRSFSRSDHLALH 423
Zfish 424 MKRH 427 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klf5a | XP_001344916.5 | COG5048 | 322..>408 | CDD:227381 | 32/128 (25%) |
C2H2 Zn finger | 350..369 | CDD:275368 | 6/18 (33%) | ||
zf-H2C2_2 | 361..>378 | CDD:290200 | 9/16 (56%) | ||
C2H2 Zn finger | 377..399 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 391..416 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 407..427 | CDD:275368 | 7/19 (37%) | ||
mamo | NP_572932.2 | BTB | 21..118 | CDD:279045 | |
BTB | 32..118 | CDD:197585 | |||
C2H2 Zn finger | 1082..1105 | CDD:275368 | |||
C2H2 Zn finger | 1116..1137 | CDD:275368 | |||
C2H2 Zn finger | 1149..1169 | CDD:275368 | |||
zf-C2H2 | 1469..1491 | CDD:278523 | 8/23 (35%) | ||
C2H2 Zn finger | 1471..1491 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 1483..1506 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 1499..1519 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 1511..1536 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 1527..1547 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |