DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klf5a and mamo

DIOPT Version :9

Sequence 1:XP_001344916.5 Gene:klf5a / 100006043 ZFINID:ZDB-GENE-090312-167 Length:429 Species:Danio rerio
Sequence 2:NP_572932.2 Gene:mamo / 32353 FlyBaseID:FBgn0267033 Length:1553 Species:Drosophila melanogaster


Alignment Length:394 Identity:91/394 - (23%)
Similarity:129/394 - (32%) Gaps:147/394 - (37%)


- Green bases have known domain annotations that are detailed below.


Zfish   146 SSSGPAPSAL------PDFTSIFNSNSTSGSGMDVVDDSAGVFVKQEMQGF--DIPQDGP----- 197
            |.|||:.||:      |  ||:..|.|.:....|||..|....:..|.:..  ::.::|.     
  Fly  1189 SGSGPSSSAISVSVAAP--TSVSASGSVTSVDQDVVTSSQEPMLADEGEDLRVNVKREGTADEQS 1251

Zfish   198 ------------------------LFQLLNSELDV----------------------------PD 210
                                    |:|..||....                            .|
  Fly  1252 AESRANDLEEHEQDNTVDSAGITMLYQDNNSSASASTSATEPNISSSDGIHSTNKRSRLHHLETD 1316

Zfish   211 PTDPHAHSQMPTFHNLHLAAQQTAAKSYCGMAAHGYPLSHGHFVHPQDQAHSQLKMTYLPPSPPT 275
            |:.||.|..    |:.|...||           | :...|.|. :||.|..:.|....| |...|
  Fly  1317 PSYPHHHHH----HHHHHHQQQ-----------H-HQAQHQHH-NPQSQLPTHLGHVSL-PLVAT 1363

Zfish   276 SEPGSPDRQKELLHNLTPPPSYAATIASKMA----GHAPSHPTPASARPPTTTGS---------- 326
            |..||           :...:.||.:|:..|    |...|..|.:.|......||          
  Fly  1364 SAAGS-----------SSSAAAAAVVAAAQAQVSSGATGSGATGSGAPGSGNVGSAGSSGAGGGI 1417

Zfish   327 --------------MPVRYNRRTNPD------------LEKRRIHH-------CDFPGCKKVYTK 358
                          :|.......||.            .|::|...       |.|  |.|....
  Fly  1418 SSLSSLTSLINAERIPNEQFLGLNPQEASILNFLRVDAAERQRDKRPATSRFACPF--CGKCVRS 1480

Zfish   359 SSHLKAHLRTHTGEKPYRCTWEGCDWRFARSDELTRHFRKHTGAKPFQCAVCSRSFSRSDHLALH 423
            ..:||.|:|.||||:|:.|.:  |...|....:||||.|.|||.:|:.|..|.:.|:|:|:|:.|
  Fly  1481 KENLKLHVRKHTGERPFVCLF--CGRAFGGKSDLTRHLRIHTGERPYHCESCGKCFARADYLSKH 1543

Zfish   424 MKRH 427
            :..|
  Fly  1544 LTTH 1547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klf5aXP_001344916.5 COG5048 322..>408 CDD:227381 32/128 (25%)
C2H2 Zn finger 350..369 CDD:275368 6/18 (33%)
zf-H2C2_2 361..>378 CDD:290200 9/16 (56%)
C2H2 Zn finger 377..399 CDD:275368 8/21 (38%)
zf-H2C2_2 391..416 CDD:290200 12/24 (50%)
C2H2 Zn finger 407..427 CDD:275368 7/19 (37%)
mamoNP_572932.2 BTB 21..118 CDD:279045
BTB 32..118 CDD:197585
C2H2 Zn finger 1082..1105 CDD:275368
C2H2 Zn finger 1116..1137 CDD:275368
C2H2 Zn finger 1149..1169 CDD:275368
zf-C2H2 1469..1491 CDD:278523 8/23 (35%)
C2H2 Zn finger 1471..1491 CDD:275368 8/21 (38%)
zf-H2C2_2 1483..1506 CDD:290200 11/24 (46%)
C2H2 Zn finger 1499..1519 CDD:275368 8/21 (38%)
zf-H2C2_2 1511..1536 CDD:290200 12/24 (50%)
C2H2 Zn finger 1527..1547 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.