powered by:
Protein Alignment si:dkey-51a16.9 and HRD1
DIOPT Version :9
Sequence 1: | XP_001344370.3 |
Gene: | si:dkey-51a16.9 / 100005267 |
ZFINID: | ZDB-GENE-030616-560 |
Length: | 132 |
Species: | Danio rerio |
Sequence 2: | NP_014630.1 |
Gene: | HRD1 / 854149 |
SGDID: | S000005373 |
Length: | 551 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 15/55 - (27%) |
Similarity: | 27/55 - (49%) |
Gaps: | 10/55 - (18%) |
- Green bases have known domain annotations that are detailed below.
Zfish 68 CAVCLEE---------FRSRDELGV-CPCSHAFHKKCLVKWLEIRSVCPMCNKPI 112
|.:|::| ::::::... .||.|..|..||..|:|....||:|..|:
Yeast 349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPV 403
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
si:dkey-51a16.9 | XP_001344370.3 |
zf-RING_2 |
67..108 |
CDD:290367 |
13/49 (27%) |
HRD1 | NP_014630.1 |
HRD1 |
5..551 |
CDD:227568 |
15/55 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.