DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and Rnf122

DIOPT Version :9

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:NP_001355302.1 Gene:Rnf122 / 68867 MGIID:1916117 Length:165 Species:Mus musculus


Alignment Length:105 Identity:74/105 - (70%)
Similarity:88/105 - (83%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 LPLNVYLIILGIGLFIFMLSMIFCCY-LFRLRRQGTQEQYGYNEVVLKGPGKKLSLLGQTCAVCL 72
            ||||:|::|.|.|:|:||||:||||| :.:||.|...|:|||.||||||..|||.|.||||||||
Mouse    43 LPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCL 107

Zfish    73 EEFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMCNKPI 112
            |:|:.:|||||.||.||||:||||||||:|.|||||||||
Mouse   108 EDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 zf-RING_2 67..108 CDD:290367 31/40 (78%)
Rnf122NP_001355302.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG44968
OrthoDB 1 1.010 - - D1625209at2759
OrthoFinder 1 1.000 - - FOG0001067
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22763
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.