DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and sip3

DIOPT Version :9

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster


Alignment Length:150 Identity:35/150 - (23%)
Similarity:58/150 - (38%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish     5 ITGRLPLNVYLIILGIGLFIFMLSM-IFCCYLFRLRRQGTQEQYGYNEVVLK------------- 55
            :.|.:.:.:|::.:.|...|:.|.| :|....|.:|    ..:...|:|::.             
  Fly   216 VIGLIKVVLYILFVVIMAKIYALPMFVFRPMFFTIR----NFRKALNDVIMSRRAIRNMNTLYPD 276

Zfish    56 GPGKKLSLLGQTCAVCLEEFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMCNKPICRLQPD-- 118
            ...::|......|.:|.|:..:..:  ..||.|.||..||..|.:.:..||.|...|.| .|.  
  Fly   277 ATPEELRQSDNICIICREDMVNHSK--KLPCGHIFHTTCLRSWFQRQQTCPTCRLNILR-TPTVN 338

Zfish   119 ----PPQG----AEGPQNPL 130
                |.||    |....||:
  Fly   339 STAMPRQGDEAVAAAAGNPI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 zf-RING_2 67..108 CDD:290367 13/40 (33%)
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 35/149 (23%)
zf-RING_2 287..328 CDD:290367 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.