powered by:
Protein Alignment si:dkey-51a16.9 and mura
DIOPT Version :9
Sequence 1: | XP_001344370.3 |
Gene: | si:dkey-51a16.9 / 100005267 |
ZFINID: | ZDB-GENE-030616-560 |
Length: | 132 |
Species: | Danio rerio |
Sequence 2: | NP_731367.2 |
Gene: | mura / 41145 |
FlyBaseID: | FBgn0037705 |
Length: | 1173 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 25/62 - (40%) |
Similarity: | 31/62 - (50%) |
Gaps: | 7/62 - (11%) |
- Green bases have known domain annotations that are detailed below.
Zfish 47 YGYNEVVLKGPGKKLSLLGQTCAVCLEEFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMC 108
|.:|..|..|. ..:|.||:.:|..|..|.|.||||.||.||:.|||.....||:|
Fly 1063 YKFNPEVHNGD-------QSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPIC 1117
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.