DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and Iru

DIOPT Version :10

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster


Alignment Length:45 Identity:17/45 - (37%)
Similarity:30/45 - (66%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish    68 CAVCLEEFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMCNKPI 112
            |::|.::|:..:.:...||||.:|:.|:|.||.:.|.||:|.|.:
  Fly   253 CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 RING_Ubox 66..112 CDD:473075 17/43 (40%)
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 15/40 (38%)
HRD1 <253..372 CDD:227568 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.