DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and gzl

DIOPT Version :9

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster


Alignment Length:126 Identity:40/126 - (31%)
Similarity:62/126 - (49%) Gaps:26/126 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish     5 ITGRLPLNV-------YLIILGIGLFIFMLSMIFCCYLFRLRRQGTQEQYGYNEVVLKGPGKKLS 62
            |...||.|:       :.|::|:...|.::.||:.|    :|.|....::...:.:|    |||.
  Fly   163 INDELPFNINTQLILPFSILIGMCFIIMVIYMIYKC----IREQRRLRRHRLPKSML----KKLP 219

Zfish    63 LLG----------QTCAVCLEEFRSRDELGVCPCSHAFHKKCLVKWL-EIRSVCPMCNKPI 112
            :|.          .||.:|||:|...|:|.|.||||.:|..|:..|| |.|.|||:|.:.:
  Fly   220 VLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 zf-RING_2 67..108 CDD:290367 22/41 (54%)
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 3/7 (43%)
zf-RING_2 233..277 CDD:290367 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.