powered by:
Protein Alignment si:dkey-51a16.9 and SPAC57A7.09
DIOPT Version :9
Sequence 1: | XP_001344370.3 |
Gene: | si:dkey-51a16.9 / 100005267 |
ZFINID: | ZDB-GENE-030616-560 |
Length: | 132 |
Species: | Danio rerio |
Sequence 2: | NP_593372.1 |
Gene: | SPAC57A7.09 / 2542187 |
PomBaseID: | SPAC57A7.09 |
Length: | 372 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 71 |
Identity: | 24/71 - (33%) |
Similarity: | 35/71 - (49%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Zfish 52 VVLKGPGKKLSLLGQTCAVCLEEFRSRDELGVCPCSHAFHKKCLVKWL-EIRSVCPMCNKPICRL 115
|.|.....:.:..|..|.:|||.|...|::...||.|.||:.|:.||: :.|..||.||..:
pombe 305 VPLMDESTRRATFGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV--- 366
Zfish 116 QPDPPQ 121
.||:
pombe 367 --PPPK 370
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001067 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.