DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and SPAC57A7.09

DIOPT Version :9

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:71 Identity:24/71 - (33%)
Similarity:35/71 - (49%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


Zfish    52 VVLKGPGKKLSLLGQTCAVCLEEFRSRDELGVCPCSHAFHKKCLVKWL-EIRSVCPMCNKPICRL 115
            |.|.....:.:..|..|.:|||.|...|::...||.|.||:.|:.||: :.|..||.||..:   
pombe   305 VPLMDESTRRATFGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV--- 366

Zfish   116 QPDPPQ 121
              .||:
pombe   367 --PPPK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 zf-RING_2 67..108 CDD:290367 17/41 (41%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 22/68 (32%)
Peptidases_S8_S53 <144..211 CDD:299169
zf-RING_2 320..362 CDD:290367 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001067
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.