DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and rnf24

DIOPT Version :9

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:XP_031751089.1 Gene:rnf24 / 100485988 XenbaseID:XB-GENE-944529 Length:158 Species:Xenopus tropicalis


Alignment Length:128 Identity:68/128 - (53%)
Similarity:94/128 - (73%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 LPLNVYLIILGIGLFIFMLSMIFCCYLFRLRRQGTQEQYGYNEVVLKGPGKKLSLLGQTCAVCLE 73
            ||||:|:::.|..:|:|:||::|||||.|||.|..:|.|.|.:|:||...|:|:|. :.||||||
 Frog    30 LPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQARKELYAYKQVILKEKVKELNLY-EICAVCLE 93

Zfish    74 EFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMCNKPICRL-------QPDPPQG-AEGPQN 128
            ||:.:||||:|||.||||:|||:||||:|.|||:||.|:.:|       :..|||| ..|.:|
 Frog    94 EFKPKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSNQEHGPPQGPLPGAEN 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 zf-RING_2 67..108 CDD:290367 30/40 (75%)
rnf24XP_031751089.1 RING-H2_RNF24_like 86..132 CDD:319383 32/45 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625209at2759
OrthoFinder 1 1.000 - - FOG0001067
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.