DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-51a16.9 and rnf128

DIOPT Version :9

Sequence 1:XP_001344370.3 Gene:si:dkey-51a16.9 / 100005267 ZFINID:ZDB-GENE-030616-560 Length:132 Species:Danio rerio
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:106 Identity:31/106 - (29%)
Similarity:47/106 - (44%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish    20 IGLFIFMLSMIFCCYLFRLRRQGTQEQYGYNEVVLKGPGK-KLSLL----------GQTCAVCLE 73
            :|.|||     :....:||.|...::.........|..|| :|..:          |.:||||:|
 Frog   204 VGYFIF-----YSARRWRLTRAQNKKMKQLKAEAKKAIGKLQLRTIKQGDKVLGPDGDSCAVCIE 263

Zfish    74 EFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMCNKPICR 114
            .::..|.:.:..|:|.|||.|:..||.....||||...|.:
 Frog   264 PYKPSDVVRILTCNHFFHKNCIDPWLLEHRTCPMCKCDILK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-51a16.9XP_001344370.3 zf-RING_2 67..108 CDD:290367 16/40 (40%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037
COG5540 <208..302 CDD:227827 28/98 (29%)
RING-H2_RNF128_like 256..304 CDD:319716 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.