DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and NMA111

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_014276.1 Gene:NMA111 / 855600 SGDID:S000005067 Length:997 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:51/200 - (25%)
Similarity:90/200 - (45%) Gaps:23/200 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MGSPFSLKNTITSGIISSAQRGSKELG---LSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGIN 62
            :|:....|.:|.:|.||...|.:.|.|   .::.|.:|||..|:...|:||.|::|:||..:.:.
Yeast   187 VGNDAGEKLSILAGFISRIDRNAPEYGELTYNDFNTEYIQAAASASGGSSGSPVVNIDGYAVALQ 251

Zfish    63 TMKVT-AGISFAIPLGRV-RLFLDRSADK-------QKSWFGESGWKRRYIGVMMLTLTPSIIEE 118
            ....| |...|.:||.|: |..:....:|       |..|.     .:.|.....|.||.....|
Yeast   252 AGGSTEASTDFFLPLDRILRALICIQTNKPITRGTIQVQWL-----LKPYDECRRLGLTSERESE 311

Zfish   119 LRMRDPSFPDISHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEI--YNAVRTSESLNV 181
            .|.:   ||: :.|:|:...::........:|.||.:|.|||..:::..::  .......:.:.:
Yeast   312 ARAK---FPE-NIGLLVAETVLREGPGYDKIKEGDTLISINGETISSFMQVDKIQDENVGKEIQL 372

Zfish   182 VVRRG 186
            |::||
Yeast   373 VIQRG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102 21/62 (34%)
PDZ_serine_protease 102..186 CDD:238487 18/85 (21%)
NMA111NP_014276.1 DegQ 48..391 CDD:223343 50/199 (25%)
PDZ_1 392..469 CDD:372324
DegQ 543..870 CDD:223343
PDZ <810..862 CDD:412172
PDZ 869..944 CDD:412172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I3096
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.