DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and Htra2

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_062726.3 Gene:Htra2 / 64704 MGIID:1928676 Length:458 Species:Mus musculus


Alignment Length:200 Identity:134/200 - (67%)
Similarity:168/200 - (84%) Gaps:1/200 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MGSPFSLKNTITSGIISSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65
            |||||:|:|||||||:|||||.:::|||..:|::||||||.||||||||||:||||||||:||||
Mouse   260 MGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMK 324

Zfish    66 VTAGISFAIPLGRVRLFLDRSADKQKSWFGESGWKRRYIGVMMLTLTPSIIEELRMRDPSFPDIS 130
            ||||||||||..|:|.||.| .:|:.||||.||.:|||||||||||||||:.||::|:|||||:.
Mouse   325 VTAGISFAIPSDRLREFLHR-GEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQ 388

Zfish   131 HGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVRTSESLNVVVRRGADLLMLHMT 195
            ||||||:||:||||:|||::|||||:.|.......:|::|.||||...|.|.:|||::.|.|::|
Mouse   389 HGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVT 453

Zfish   196 PESTE 200
            ||.||
Mouse   454 PEVTE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102 45/59 (76%)
PDZ_serine_protease 102..186 CDD:238487 52/83 (63%)
Htra2NP_062726.3 DegQ 125..454 CDD:223343 129/194 (66%)
IAP-binding motif. /evidence=ECO:0000250 134..137
Serine protease 166..342 62/81 (77%)
Trypsin_2 182..320 CDD:290102 45/59 (76%)
PDZ_serine_protease 360..452 CDD:238487 56/91 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C193130088
Domainoid 1 1.000 209 1.000 Domainoid score I12021
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 463 1.000 Inparanoid score I6935
OMA 1 1.010 - - QHG43674
OrthoDB 1 1.010 - - D210946at7742
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm30105
orthoMCL 1 0.900 - - OOG6_100391
Panther 1 1.100 - - LDO PTHR22939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.