DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and HtrA2

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster


Alignment Length:204 Identity:104/204 - (50%)
Similarity:155/204 - (75%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MGSPFSLKNTITSGIISSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65
            :|||.:|.||:|:|:|||.||.|:||||.|.:::|:||||.|.||||||||:|||||.||:|:||
  Fly   220 LGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK 284

Zfish    66 VTAGISFAIPLGRVRLFLDRSADKQKSWFGESGWK-----RRYIGVMMLTLTPSIIEELRMRDPS 125
            ||||||||||:..|::||:|:|:|:|.   .|.:|     :||:|:.||||||.|:.||:.|..:
  Fly   285 VTAGISFAIPIDYVKVFLERAAEKRKK---GSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQN 346

Zfish   126 FP-DISHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVR-TSESLNVVVRRGAD 188
            .| :::||||:.:|||||||:..|::|||::..||..::..|.::|:|:. .|::|::|:.||..
  Fly   347 MPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVK 411

Zfish   189 LLMLHMTPE 197
            .:.:.:|||
  Fly   412 QMHVTITPE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102 39/59 (66%)
PDZ_serine_protease 102..186 CDD:238487 37/85 (44%)
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 104/204 (51%)
Trypsin_2 141..280 CDD:290102 39/59 (66%)
PDZ_serine_protease 323..417 CDD:238487 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579598
Domainoid 1 1.000 176 1.000 Domainoid score I3556
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 326 1.000 Inparanoid score I2456
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238833at33208
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm25664
orthoMCL 1 0.900 - - OOG6_100391
Panther 1 1.100 - - LDO PTHR22939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.