DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and SPAC23G3.12c

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_593112.1 Gene:SPAC23G3.12c / 2541812 PomBaseID:SPAC23G3.12c Length:996 Species:Schizosaccharomyces pombe


Alignment Length:229 Identity:53/229 - (23%)
Similarity:102/229 - (44%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MGSPFSLKNTITSGIISSAQRGSK---ELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGIN 62
            :|:..:.|.:|.:|.||...|...   ||...:.|.:|||..|....|:||.|::..:|.|:.:.
pombe   167 VGNDAAEKLSILAGWISRIDRNVPDYGELTYCDFNTNYIQAAANASGGSSGSPVVERNGNVVALQ 231

Zfish    63 T-MKVTAGISFAIPLGR----VRL---------------FLDRSADKQKSWFGESGWKRRYIGVM 107
            . ..:.|...:.:||.|    :|.               ||.::.|:                ..
pombe   232 AGGHMIAATDYFLPLDRPLRALRCLQNNTPITRGTIQAQFLIKTFDE----------------CS 280

Zfish   108 MLTLTPSIIEELRMRDPSFPDISHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNA 172
            .|.|..::.|::|   ..||:.:..:::..|:...|:.:. :|.||:::.:|.:.:....|:.:.
pombe   281 RLGLDSAMEEKVR---TLFPEATSMLVVETVLPEGPSFKK-LKEGDILLYVNSMILINLIELESI 341

Zfish   173 VRTSESLNVV--VRRGADLLMLHMTPESTEGHQV 204
            :..|...:||  |:||::|:.|..|.:||  |.:
pombe   342 LDESVGKDVVLTVQRGSELVELTCTAQST--HDI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102 20/62 (32%)
PDZ_serine_protease 102..186 CDD:238487 17/85 (20%)
SPAC23G3.12cNP_593112.1 DegQ 38..369 CDD:223343 50/221 (23%)
Trypsin_2 84..230 CDD:290102 20/62 (32%)
PDZ_serine_protease 289..365 CDD:238487 19/79 (24%)
PDZ_1 372..448 CDD:289574 0/2 (0%)
DegQ <551..834 CDD:223343
Tryp_SPc 551..698 CDD:304450
PDZ <779..834 CDD:294084
PDZ 844..919 CDD:294084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4178
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.