DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and psmd-9

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_001379558.1 Gene:psmd-9 / 24104302 WormBaseID:WBGene00016623 Length:197 Species:Caenorhabditis elegans


Alignment Length:204 Identity:47/204 - (23%)
Similarity:71/204 - (34%) Gaps:70/204 - (34%)


- Green bases have known domain annotations that are detailed below.


Zfish    24 KELGL----SNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPLGR---VRL 81
            |||.|    :||.||              .||  ||.|...:||:.|     :|:...|   :.|
 Worm    22 KELMLVLETNNSTMD--------------SPL--LDAEGYPLNTIDV-----YAVRHARHDLICL 65

Zfish    82 FLDRSADKQKSWFGESGWKRRYIGVMMLTLTPSIIEELRMRDPSFPD---ISHGVLIHR------ 137
            ..||:|                       ||..|:.|:...:.....   .|....:||      
 Worm    66 RNDRAA-----------------------LTEKIVVEMENENKEVSGQTATSEEKPVHRTSNEPF 107

Zfish   138 -----VIVGSPANRAGMKPGDVIIEINGV---KVNTSEEIYNAVRTSES--LNVVVRRGADLLML 192
                 |:..|||:..|.:..|:||:...:   ..|..:|:....:.||.  :.|.|.|....:.|
 Worm   108 VKISSVVELSPADIGGFRKDDLIIQYGNLHHGNFNDMQEVAQITKQSEDKIIRVTVIRENRPVRL 172

Zfish   193 HMTPESTEG 201
            .:.|:...|
 Worm   173 EICPKKWSG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102 13/40 (33%)
PDZ_serine_protease 102..186 CDD:238487 21/102 (21%)
psmd-9NP_001379558.1 Nas2_N 7..81 CDD:408080 26/102 (25%)
PDZ_6 110..165 CDD:407688 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.