DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and rhgf-1

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_509791.4 Gene:rhgf-1 / 184419 WormBaseID:WBGene00006468 Length:1340 Species:Caenorhabditis elegans


Alignment Length:92 Identity:24/92 - (26%)
Similarity:40/92 - (43%) Gaps:20/92 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish   126 FPDISHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKV--NTSEEIYNAVRTSESLNVVVRRGAD 188
            ||     |.:|.:.....|..||::.||.|:::||:.|  |..:|:...:  |...||.      
 Worm    70 FP-----VYVHTLKQDGAAYCAGVRQGDRIVKVNGMSVSPNNHKEVLQMI--SNGHNVA------ 121

Zfish   189 LLMLHMTPE-----STEGHQVKYLVRL 210
            |.:|...|:     |....||:..:.:
 Worm   122 LTLLGKPPDPISNISFPNQQVEQKIHI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102
PDZ_serine_protease 102..186 CDD:238487 18/61 (30%)
rhgf-1NP_509791.4 PDZ 49..125 CDD:214570 19/67 (28%)
RGS-like 246..443 CDD:286245
C1 485..534 CDD:237996
RhoGEF 743..940 CDD:238091
PH_RhoGEF 983..1090 CDD:275411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.