powered by:
Protein Alignment si:dkey-33c12.12 and lim-8
DIOPT Version :9
Sequence 1: | NP_001082916.2 |
Gene: | si:dkey-33c12.12 / 100000024 |
ZFINID: | ZDB-GENE-081028-30 |
Length: | 214 |
Species: | Danio rerio |
Sequence 2: | NP_741201.1 |
Gene: | lim-8 / 175952 |
WormBaseID: | WBGene00017904 |
Length: | 1099 |
Species: | Caenorhabditis elegans |
Alignment Length: | 76 |
Identity: | 25/76 - (32%) |
Similarity: | 44/76 - (57%) |
Gaps: | 10/76 - (13%) |
- Green bases have known domain annotations that are detailed below.
Zfish 133 VLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEE------IYNAVRTSESLNVVVRRG---AD 188
|::..|||||||::||:..||.|:.|||.:::...: ::.|.|..|: :|::.|. |.
Worm 444 VIVESVIVGSPADKAGLLVGDTILSINGEEMSDKYQSGVTRILHEAARVGEA-DVLILRAPVPAP 507
Zfish 189 LLMLHMTPEST 199
:|...|:..|:
Worm 508 MLSKQMSTSSS 518
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.