DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and gras-1

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:NP_492164.1 Gene:gras-1 / 172549 WormBaseID:WBGene00009272 Length:245 Species:Caenorhabditis elegans


Alignment Length:109 Identity:27/109 - (24%)
Similarity:45/109 - (41%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


Zfish   120 RMRDPSFPDISHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSE--EIYNAVRTSESLNVV 182
            |....|:..|::   :..|...|||:|.|:..||::|.:|...|.|:.  ||..::.....:::|
 Worm    80 RTSSNSYERITY---VDYVSADSPADRCGITRGDMVIAVNEKSVVTASHAEIVESIAQCLQVSLV 141

Zfish   183 -----VRRGADLLM---------------LHMTPESTEGHQVKY 206
                 |.|..:|.|               |.|..::.|..|..|
 Worm   142 LVFKDVARIVELSMRSIQLRFMLDAKIRELRMLEKTEEDLQALY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102
PDZ_serine_protease 102..186 CDD:238487 19/72 (26%)
gras-1NP_492164.1 PDZ 67..145 CDD:238080 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.