DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-33c12.12 and htra2

DIOPT Version :9

Sequence 1:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio
Sequence 2:XP_031750958.1 Gene:htra2 / 100492982 XenbaseID:XB-GENE-6044196 Length:436 Species:Xenopus tropicalis


Alignment Length:202 Identity:135/202 - (66%)
Similarity:161/202 - (79%) Gaps:2/202 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MGSPFSLKNTITSGIISSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMK 65
            |||||||:|||||||:||.|||..||||:|.:|:||||||.||||||||||:|||||||||||||
 Frog   235 MGSPFSLQNTITSGIVSSVQRGGHELGLANRDMEYIQTDAAIDFGNSGGPLVNLDGEVIGINTMK 299

Zfish    66 VTAGISFAIPLGRVRLFLDRSADK--QKSWFGESGWKRRYIGVMMLTLTPSIIEELRMRDPSFPD 128
            |..|||||||..|||.||.....:  |.|..|.|..||||||||||||||.|:.||:.|||||||
 Frog   300 VVPGISFAIPSDRVREFLQHGEKRRSQGSLLGSSEVKRRYIGVMMLTLTPKILAELKFRDPSFPD 364

Zfish   129 ISHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVRTSESLNVVVRRGADLLMLH 193
            :|||||||:|||||||:.:|::.|||::|||..:..|||:||:||.|...|.::||||::.||:.
 Frog   365 VSHGVLIHKVIVGSPAHESGLRAGDVVLEINAKRAMTSEDIYDAVHTHPKLTMIVRRGSESLMVT 429

Zfish   194 MTPESTE 200
            :.||.||
 Frog   430 VIPECTE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102 48/59 (81%)
PDZ_serine_protease 102..186 CDD:238487 54/83 (65%)
htra2XP_031750958.1 degP_htrA_DO 125..>431 CDD:273938 131/195 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I11048
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 440 1.000 Inparanoid score I7342
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D210946at7742
OrthoFinder 1 1.000 - - FOG0000153
OrthoInspector 1 1.000 - - otm36365
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X265
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.