DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AKT3 and JIL-1

DIOPT Version :9

Sequence 1:NP_001357003.1 Gene:AKT3 / 10000 HGNCID:393 Length:479 Species:Homo sapiens
Sequence 2:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster


Alignment Length:392 Identity:146/392 - (37%)
Similarity:218/392 - (55%) Gaps:34/392 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   118 NCSPTSQIDNIGEEEMDASTT--------HHKRKTMNDFDYLKLLGKGTFGKVILVREKA---SG 171
            |.:|....:...:.:::|.|.        ..:..::|||..:::||.|.:|:|.|||:..   :|
  Fly   223 NSTPLDLDNEAHQRDLEAVTDLKYYVKLYSDEAVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAG 287

Human   172 KYYAMKILKKEVIIAKDEVA-HTLTESRVLKN-TRHPFLTSLKYSFQTKDRLCFVMEYVNGGELF 234
            |.||||:|.|..::.|.:.| ||.||..||:. .|:|||.||.|:||:..:|..|:::.||||||
  Fly   288 KLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELF 352

Human   235 FHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITD 299
            .||.....|.|.|.|.|.||:|.||:.||...|:|||:||||::||.:|||.::||||.|  |..
  Fly   353 THLYHSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSDFGLSK--ILT 415

Human   300 AAT---MKTFCGTPEYLAPEVLEDNDYGR--AVDWWGLGVVMYEMMCGRLPFYNQD----HEKLF 355
            |..   ..:||||.||:|||::.....|.  |||||.:||:.:|::.|..||...|    ..::.
  Fly   416 AENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEIS 480

Human   356 ELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP 420
            ..|..|....|.:.|::|:..:..:|.|:|.:||||...||.||..|.||:|:|||::..|:...
  Fly   481 RRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQELRTKRRKA 545

Human   421 PFKPQVTSETDTRYFDEEFTAQT----ITITPPEK------YDEDGMDCMDNERRPHFPQFSYSA 475
            |:||.:|:|.|.:.|..|||.|.    ....||.:      |.....:.::..||.:..:..|..
  Fly   546 PYKPTLTAEDDVQNFSNEFTDQVPEDPECDAPPSRIRLFRGYTYVAPEHLEQMRRDNHCEIQYFN 610

Human   476 SG 477
            :|
  Fly   611 TG 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AKT3NP_001357003.1 PH_PKB 4..110 CDD:269947
STKc_PKB_gamma 132..479 CDD:270745 144/378 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..479 4/20 (20%)
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 115/270 (43%)
STKc_MSK_N 266..533 CDD:270735 116/268 (43%)
S_TK_X 532..591 CDD:214529 19/58 (33%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.